PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G161300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 236aa    MW: 25621 Da    PI: 8.561
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G161300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.83.8e-32156214159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+
  Brast09G161300.2.p 156 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHT 214
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-33141214IPR003657WRKY domain
SuperFamilySSF1182902.09E-28148214IPR003657WRKY domain
PROSITE profilePS5081128.92151213IPR003657WRKY domain
SMARTSM007741.4E-37156215IPR003657WRKY domain
PfamPF031064.1E-25157213IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEGTSRLEAC LPSLYTLDPY TAPPPLPPFL APLPNQHKLL QQMPLVVQEQ SGNHGVMFSS  60
DHGGGGLYPL LPGIPFCHSA AASDKPATGF APLAAAEVGT SAAIAGNEVA STTTATTATS  120
HGASSWKGTE KGKMKVRRKM REPRFCFQTR SDVDVLDDGY KWRKYGQKVV KNSLHPRSYY  180
RCTHSNCRVK KRVERLSEDC RMVITTYEGR HTHTPCSDDD AAGGEHTGAC AFTYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-24147213874Probable WRKY transcription factor 4
2lex_A1e-24147213874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751531.11e-139PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY42e-58WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0Q3KUK21e-139A0A0Q3KUK2_BRADI; Uncharacterized protein
STRINGBRADI5G17395.11e-123(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.16e-58WRKY family protein